PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00260.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 595aa    MW: 67458.1 Da    PI: 7.1916
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00260.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.44.8e-084004371954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yps  ++  LA++ gL+ +qV++WF N R +
  Rsa1.0_00260.1_g00002.1 400 FEHflHPYPSDVDKHILARQSGLSRSQVSNWFINARVR 437
                              554459******************************88 PP

2BELL1024.2e-33258329172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              e++elqk+kakLl +lee+++rY +y+eq++  + +Fe+++g+g+a++Yt+lA++a+SrhFrcLkd +++qi
  Rsa1.0_00260.1_g00002.1 258 EFMELQKRKAKLLAMLEELKRRYGHYREQMRLAAQAFEVAVGVGAAEMYTALASRAMSRHFRCLKDGLVGQI 329
                              679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-58179327IPR006563POX domain
PfamPF075261.4E-40185325IPR006563POX domain
PROSITE profilePS5007111.726378441IPR001356Homeobox domain
CDDcd000867.50E-10381442No hitNo description
SMARTSM003895.5E-8381445IPR001356Homeobox domain
SuperFamilySSF466891.71E-16382449IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-26384448IPR009057Homeodomain-like
PfamPF059208.8E-17398437IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MASDQFHGHN HHQQHQHQMI NQIHGFDERN NNPTDHQQHH YNQQIFGSNS NMGMMIDFSR  60
HHQTGITSGM DHHHYHHQTS GGTVQNQLFE DSSSSMTMRL CSVNNNFSSE VNDERAPQRP  120
SQGLSLSLSS SNPTSISLQS FDLRPQQQGY SGKSTHHQNL PHSQMMMLMN SHHQNNNSNH  180
HQFQIGSSKY LIAAQELLRE FCSLGVKESD DEVMMKHKRK QKGKQQEDWD TSNNNKDQHE  240
QSATISSKKH VPPLHSLEFM ELQKRKAKLL AMLEELKRRY GHYREQMRLA AQAFEVAVGV  300
GAAEMYTALA SRAMSRHFRC LKDGLVGQIQ ATSQALGERD EDNRGVSIAA RGETPRLRLL  360
DQALRQQKSY RQMSLVEAHP WRPQRGLPER AVTALRAWLF EHFLHPYPSD VDKHILARQS  420
GLSRSQVSNW FINARVRLWK PMIEEMYCEE TRGAEEQQME ITNPMFMDTK PDPNQIMRVE  480
PESLSSVVTK TGHKDNSNLG TASFGSTFDF SSYSNQAVTY TGEGGARDVS LTLGLQNGAV  540
SLALSPVTAQ GGPLYYGRDH MEGSVQYTAS MLDDDQAQNL PCMNLMGAQS LHDMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B5e-15387445563Homeobox protein Meis2
3k2a_A5e-15387445563Homeobox protein Meis2
4xrm_B5e-15387445563Homeobox protein Meis2
4xrm_A5e-15387445563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528660.0AK352866.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-O06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140091.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388970.0BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM4E9P10.0M4E9P1_BRARP; Uncharacterized protein
STRINGBra025497.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58662639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.10.0TALE family protein